PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016433661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 93aa    MW: 10260.3 Da    PI: 8.2128
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016433661.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.66.3e-332177359
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    +vrYkeC+kNhAa++Gg+avDGC+E+mp +geegt +a++CaACgCHRnFHRr+v+e
  XP_016433661.1 21 SVRYKECQKNHAARVGGYAVDGCREYMPISGEEGTNSAFTCAACGCHRNFHRRQVVE 77
                    69***************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-21180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-292275IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-272374IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.9742474IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MKKLQLYLKR EDSSINSANF SVRYKECQKN HAARVGGYAV DGCREYMPIS GEEGTNSAFT  60
CAACGCHRNF HRRQVVETEV ASDSSSSSSS TNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016433661.12e-64PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW59e-32MIF2_ARATH; Mini zinc finger protein 2
TrEMBLK4B7655e-35K4B765_SOLLC; Uncharacterized protein
STRINGSolyc02g067330.1.12e-34(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.18e-30mini zinc finger 2